PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010926809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TCP
Protein Properties Length: 301aa    MW: 31578.2 Da    PI: 8.5386
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010926809.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP126.33.3e-3957135280
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80 
                     a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+pai+++tgt++++as+  a++   
  XP_010926809.1  57 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPAIIAATGTGTIPASALAAAAAAA 135
                     789******************************************************************7773322222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.2E-3262133IPR005333Transcription factor, TCP
PROSITE profilePS5136928.48863117IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDPKGSSKLP QEVPRFHQAL GLPQSDKREP TTTTPEARDA PERELAAEKE EQRRQLAPKR  60
SSNKDRHTKV DGRGRRIRMP ALCAARIFQL TRELGHKSDG ETIQWLLQQA EPAIIAATGT  120
GTIPASALAA AAAAAPMSHP AASAPAGLHQ KLDDLGQAAG PRPNWAMLGA NLARSHPGLW  180
PPPISGFNSG FAPSTSNLGS GGDSSYMQRM GLHGLELPGG NLGAMSFASL LGGHGQQLPG  240
LELGLSQDGH IGVLSPQALS QFYQQMGQGR GVSGAGSGQL QQNQQHQQTP SAEDDSQGSG  300
Q
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00005PBMTransfer from 484486Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926809.10.0PREDICTED: transcription factor TCP20-like isoform X1
RefseqXP_010926810.10.0PREDICTED: transcription factor TCP20-like isoform X2
SwissprotQ9LSD52e-71TCP20_ARATH; Transcription factor TCP20
TrEMBLM0S3K71e-121M0S3K7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P27500_0011e-121(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.14e-54TCP family protein